Recombinant Human Leptin

#
  • Catalog number
    C067-50
  • Price:

    Please ask

    Ask for price
  • Size
    50 ug
# #
  • Description
    Recombinant Human Leptin is produced by our E.coli expression system and the target gene encoding Val22-Cys167 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
  • Estimated molecular weight
    16,1 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P41159
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Gene
    Human or mouse Leptin (from Greek λεπτός leptos, "thin") the "satiety hormone", is a hormone made by adipose cells that helps to regulate energy balance by inhibiting hunger. Leptin is opposed by the actions of the hormone ghrelin, the "hunger hormone". Both hormones act on receptors in the arcuate nucleus of the hypothalamus to regulate appetite to achieve energy homeostasis. ELISA kits and peptides and antibodies are available.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
#
  • Gene target
    Leptin  
  • Gene symbol
    LEP, LEPR, LEPROT
  • Short name
    Recombinant Leptin
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human Leptin
  • Alternative technique
    rec
Gene info
  • Identity
  • Gene
    LEP
  • Long gene name
    leptin
  • Synonyms gene
  • Synonyms gene name
    • leptin (murine obesity homolog)
    • leptin (obesity homolog, mouse)
  • Locus
  • Discovery year
    1993-01-26
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Neuropeptides
  • VEGA ID
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee